Filter
–
Service hotline
Telephone support and professional advice under:
+49(0)731-3608-123
Or via our contact form.
- Bioactive Proteins
Endotheliales Rindermitogen (ECGS) - Calmodulin - Natürliches Mauslaminin - rHu cellular Fibronectin - rHu Decorin - rHu EpCAM - rHu HER2-ECD - rHu Thrombospondin - rHu Vitronectin
ACTH (4-10), human MEHFRWG
From
€85.50*
ACTH (4-10), human MEHFRWGÂ is a synthetic peptide according to the amino acids 4 to 10 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates secretion of glucocorticoids such as cortisol, and has little control over secretion of aldosterone, the other major steroid hormone from the adrenal cortex. Stimulates secretion of adrenal corticosteroids and induces growth of adrenal cortex. ACTH also called Tetracosactide directly activates G-proteins. It is also a stimulator of adenylate cyclase and cAMP formation.
FLAG-Peptide - DYKDDDDK
From
€208.00*
From
€140.00*
The DYKDDDDK peptide was specifically designed for immunoaffinity chromatography. It allows elution under mild and non-denaturing conditions. Several antibodies against this peptide have been developed.
Usual working concentration is 100µg/mL.For stock solution, dissolve in TBS (10mM Tris/HCl, 150mM NaCl, pH7.4) to a final concentration of 5mg/mL.
Variants from €140.00*
Heparin sodium salt from porcine intestinal mucosa
€503.93*
From
€132.94*
Heparin is a polysaccharide classified as mucopolysaccharide or glycosaminoglycan. In the organism, it is especially formed and stored in mast cells of various mammalian tissues such as liver, lung and mucous membrane. Heparin is mainly isolated from bovine lung, or pig intestine (intestinal mucosa).
Heparin is mainly responsible for delayed blood clotting. It enhances the antithrombin-mediated inactivation of proteases in the clotting pathway. Therefore, it is also often used as an anticoagulant in blood sampling. Thus, it binds to antithrombin III, a naturally occurring plasma protease inhibitor, thereby increasing the rate at which antithrombin III (AT-III) inhibits the coagulation of coagulating proteases, such as factor Xa or thrombin.
Heparin from Genaxxon bioscience is derived from porcine intestinal mucosa (as sodium salt, specific activity >150 units/mg). It is lyophilized and stabilizer-free. Common concentrations are 5000 units/mL. Thus, about 34 mg should be reconstituted with 5mL ultrapure water and then sterile filtered.
In solution, heparin is stable at +2°C to +8°C for up to 2 years, when previously filtered through a 0.2mm sterile filter. CAUTION: Microorganisms rapidly degrade heparin, as they use the polysaccharide side chains as a source of carbon for their own growth.
Variants from €132.94*
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKR
€238.00*
Ac-ACTH (1-17), human Ac-SYSMEHFRWGKPVGKKRÂ is a synthetic peptide according to the first 17 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates secretion of glucocorticoids such as cortisol, and has little control over secretion of aldosterone, the other major steroid hormone from the adrenal cortex. Stimulates secretion of adrenal corticosteroids and induces growth of adrenal cortex. ACTH also called Tetracosactide directly activates G-proteins. It is also a stimulator of adenylate cyclase and cAMP formation.
ACTH (1-16), human SYSMEHFRWGKPVGKK
€238.00*
ACTH (1-16), human SYSMEHFRWGKPVGKK is a synthetic peptide according to the first 16 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates secretion of glucocorticoids such as cortisol, and has little control over secretion of aldosterone, the other major steroid hormone from the adrenal cortex. Stimulates secretion of adrenal corticosteroids and induces growth of adrenal cortex. ACTH also called Tetracosactide directly activates G-proteins. It is also a stimulator of adenylate cyclase and cAMP formation.
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEF
From
€261.25*
ACTH (18-39), human RPVKVYPNGAEDESAEAFPLEFÂ is a synthetic peptide according to the amino acids 18 to 39 of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates secretion of glucocorticoids such as cortisol, and has little control over secretion of aldosterone, the other major steroid hormone from the adrenal cortex. Stimulates secretion of adrenal corticosteroids and induces growth of adrenal cortex. ACTH also called Tetracosactide directly activates G-proteins. It is also a stimulator of adenylate cyclase and cAMP formation.
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
From
€441.75*
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFÂ is a synthetic peptide according to the first 39 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates secretion of glucocorticoids such as cortisol, and has little control over secretion of aldosterone, the other major steroid hormone from the adrenal cortex. Stimulates secretion of adrenal corticosteroids and induces growth of adrenal cortex. ACTH also called Tetracosactide directly activates G-proteins. It is also a stimulator of adenylate cyclase and cAMP formation.
Chymotrypsinogen A - Chymotrypsin precursor
From
€535.60*
Chymotrypsinogen is the practically inactive "precursor" (proenzyme, or zymogen) of chymotrypsin. In order to be activated, chymotrypsinogen has to be cleaved by trypsin between the amino acids arginine and isoleucine (R15 and I16) , which leads to structural changes and the formation of the substrate binding site (Sears 2010). Chymotrypsin is a trypsin-like serine protease.
Chymotrypsin differs from trypsin in the selectivity of the cleavage site of proteins. While trypsin cleaves proteins between the amino acids Arg and Lys, Chymotrypsin prefers large hydrophobic amino acids as cleavage site.
Unit definition: The amount of activated zymogen that causes a decrease in absorbance at 237 nm of 0.0075 per minute at 25°C resulting from the hydrolysis of ATEE (NF/USP unit).
3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK
From
€246.13*
From
€301.30*
From
€246.13*
The DYKDDDDK peptide was developed specifically for immunoaffinity chromatography. The peptide allows the competitive elution of proteins (amino terminal, metaminoterminal or carboxy-terminal) FLAG® fusion proteins from anti-FLAG M1 or anti-FLAG M2 antibodies (in solution or bound and agarose) under mild, non-denaturing conditions.
Application Usual working concentration is 100µg/mL.For stock solution, dissolve in TBS (10mM Tris/HCl, 150mM NaCl, pH7.4) to a final concentration of 5mg/mL.
FLAG®: FLAG is a registered trademark of Sigma-Aldrich Co. LLC
Variants from €246.13*
human LL-37 [LL-37, 37 aa]
From
€252.49*
From
€564.40*
From
€252.49*
LL-37 human LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.
Amino acid sequence: [LL-37, 37 aa] (Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser)
Variants from €252.49*
human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
From
€594.15*
From
€241.40*
LL-37 human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.
Amino acid sequence:Â GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Variants from €241.40*
Albumin from hen egg white - Ovalbumin
€226.29*
Albumin from hen egg white (ovalbumin) is a phosphorylated glycoprotein that contains 385 amino acid residues and has a molecular weight of 42.7 kDa. Chicken egg white is the protein component with the highest amount of egg white.
It is used in protein research as a marker (approx. 45 kDa) in protein electrophoresis. In addition, it is used for structure elucidation and also serves as a comparison standard.
Bovine albumin crystallized, free of fatty acid, free of globulin
€458.66*
From
€116.27*
Albumin - crystallised is a Fraction V Albumin recrystallised 3 times at temperatures below 0°C. This procedure ensures a very native protein, that is free of carbohydrates, globulines and fatty-acids.
Variants from €116.27*
Bovine albumin Fraction V (pH 7.0)
From
€75.32*
Standard grade, lyophilised Albumin. Bovine serum albumin (BSA) is added as a stabilizing component for proteins/enzymes to several enzyme reaction and storage buffers. The concentration usually ranges from 0.01% (0.1mg/mL) to 3% (30mg/mL). BSA is added to the 10X concentrated buffers of DNA-modifying enzymes or restriction enzymes in a concentration of 0.5mg/mL. Alternatively, BSA can be substituted by gelatin for such purposes at the same concentration. Besides, albumin is applied as a blocking agent for blocking unbound surfaces of blotting membranes in immunoblots (3%) or ELISAs (3% in PBS) or for the dilution of antisera and antibody-stock solutions, respectively. In ELISAs, BSA is frequently replaced by non-fat dried milk. This fraction of albumin has been manufactured by a combination of the heat-shock method and alcohol precipitation. Albumin is stable as powder (3 years) or in solution (biological buffers like PBS, one year at +4°C to -20°C). Stock solutions are prepared in concentrations up to 20%. If crystals are formed during storage of the solutions, they can be redissolved by warming up to 37°C and mixing. Usually, sodium azide is added at a final concentration of 2 mM (or 0.02 - 0.2%) to prevent microbial contaminations.